PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00013.60
Common NameAMTR_s00013p00120040
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family MIKC_MADS
Protein Properties Length: 173aa    MW: 19984 Da    PI: 9.3864
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00013.60genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF66.42.8e-21959151
                                             S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                                   SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                                             krien   r+vtf+kRr  +l KA+E S LC+++va iifss++++yeys+
  evm_27.model.AmTr_v1.0_scaffold00013.60  9 KRIENPNARKVTFTKRRDSLLRKAFEFSLLCEVDVAAIIFSSSDEVYEYST 59
                                             79***********************************************96 PP

2K-box59.71.2e-2079154883
                                    K-box   8 sleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqi 77 
                                              s + + +e + +el+++k+ ++ L+ +++hl G+dL +L+lkeL++Le++L+++l +iR +K ++l e++
  evm_27.model.AmTr_v1.0_scaffold00013.60  79 SDQRSSTEFMMEELDNMKSTVRALEAKNKHLCGQDLLPLQLKELKKLEKELNTGLDRIRIRKRQVLSEHT 148
                                              3577889*************************************************************99 PP

                                    K-box  78 eelqkk 83 
                                                l++k
  evm_27.model.AmTr_v1.0_scaffold00013.60 149 CLLKEK 154
                                              888877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.9E-28160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006626.618161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.7E-26289IPR002100Transcription factor, MADS-box
PRINTSPR004044.7E-22323IPR002100Transcription factor, MADS-box
PfamPF003197.4E-201057IPR002100Transcription factor, MADS-box
PRINTSPR004044.7E-222338IPR002100Transcription factor, MADS-box
PRINTSPR004044.7E-223859IPR002100Transcription factor, MADS-box
PfamPF014862.5E-1680154IPR002487Transcription factor, K-box
PROSITE profilePS5129711.36785172IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 173 aa     Download sequence    Send to blast
MGRGKVQLKR IENPNARKVT FTKRRDSLLR KAFEFSLLCE VDVAAIIFSS SDEVYEYSTQ  60
DINQTISKYH RAKGTLNQSD QRSSTEFMME ELDNMKSTVR ALEAKNKHLC GQDLLPLQLK  120
ELKKLEKELN TGLDRIRIRK RQVLSEHTCL LKEKIIVYIY SEGAQEKVTV EE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_D5e-17269168Myocyte-specific enhancer factor 2A
3mu6_C5e-17269168Myocyte-specific enhancer factor 2A
3mu6_B5e-17269168Myocyte-specific enhancer factor 2A
3mu6_A5e-17269168Myocyte-specific enhancer factor 2A
1tqe_S7e-17169169Myocyte-specific enhancer factor 2B
1tqe_R7e-17169169Myocyte-specific enhancer factor 2B
1tqe_Q7e-17169169Myocyte-specific enhancer factor 2B
1tqe_P7e-17169169Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011624864.11e-110PREDICTED: MADS-box transcription factor 6
TrEMBLW1PIS81e-124W1PIS8_AMBTC; Uncharacterized protein
STRINGVIT_17s0000g01230.t013e-50(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45650.13e-28AGAMOUS-like 6
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]